SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011293 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011293
Domain Number 1 Region: 179-328
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-33
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 69-178
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-24
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-16
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011293   Gene: ENSECAG00000013094   Transcript: ENSECAT00000014158
Sequence length 945
Comment pep:known_by_projection chromosome:EquCab2:29:21017002:21158882:1 gene:ENSECAG00000013094 transcript:ENSECAT00000014158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPVVL
YFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDSEVVFELASYILQEAKGDFSS
NEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPT
YGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVH
DPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLS
EIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQ
EALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKVLP
KGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENAIN
ENRVKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDEDSQVTSTLSPLQSPHKGLPPR
PPSHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSHGHSSGH
KRFPSTGSCAEAGGGSSSLQNSPIRSLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDLSP
TRLHSLALHFRHRSSSLESQGKLLGSENDTESPDFYTPRTRSSNGSDPMDDCSSCTSHSS
SEHYYPAQMNANYSTLAEDSPSKARARQRQRQRAAGALGAANSGSMPNLAARGGGAHGSW
RGGDEGDAGRLTPSRSQILRTPSLGREGAHDKGAGRAAVSDELRQWYQRSTASHKERSRL
SHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSAALPQSQRSSTPSSEVGATPP
SSPHHILTWQTGSYSDSCFLDSSLYPELADVQWYGQEKAKPGTLV
Download sequence
Identical sequences F7AFE1
ENSECAP00000011293 9796.ENSECAP00000011293 ENSECAP00000011293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]