SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011305 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011305
Domain Number 1 Region: 6-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000812
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 2 Region: 84-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011305   Gene: ENSECAG00000013583   Transcript: ENSECAT00000014171
Sequence length 221
Comment pep:known_by_projection chromosome:EquCab2:7:5539796:5541443:-1 gene:ENSECAG00000013583 transcript:ENSECAT00000014171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPSAGSCPPSSFQCRTSGFCVPLTWRCDGDPDCTDGSDEDECRIKPCAQDGPCPPPTGSP
CSCDNIDDCPGGIDQNLHNCTRQPCPAGELRCPLGGACIPDTWLCDGHPDCPHSGDELGC
GTETFQERNTTSLGTPVTPVESVTYLQNATATPVGDEDSVQSGNWSIYGALVAAVLLSAG
LAATSLLVLSWLCARGRLYPRGLLVAVKESLLLSERKSSLL
Download sequence
Identical sequences F7A0B1
ENSECAP00000011305 9796.ENSECAP00000011305 ENSECAP00000011305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]