SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011344 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011344
Domain Number 1 Region: 21-107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-23
Family V set domains (antibody variable domain-like) 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011344   Gene: ENSECAG00000013665   Transcript: ENSECAT00000014211
Sequence length 109
Comment pep:novel chromosome:EquCab2:1:160278279:160279080:1 gene:ENSECAG00000013665 transcript:ENSECAT00000014211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVTGIAILLAFGIIGDAKTTQPNAMDCTEEETVHLPCNHSTISGNEYIYWYRQIPHQG
PEYVIYGLKSNVTNGMASLTITTDRKSSILILPQVTLRDTAVYYCIVRE
Download sequence
Identical sequences F6ZTV8
9796.ENSECAP00000011344 ENSECAP00000011344 ENSECAP00000011344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]