SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011430 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011430
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 8.89e-48
Family TRADD, N-terminal domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 146-234
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000565
Family DEATH domain, DD 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011430   Gene: ENSECAG00000013754   Transcript: ENSECAT00000014311
Sequence length 237
Comment pep:known_by_projection chromosome:EquCab2:3:17624898:17627090:-1 gene:ENSECAG00000013754 transcript:ENSECAT00000014311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALRTALAESSGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQACGRYLRAYREGALRAALQGCLEAALTLQSLLKLELRAA
AERLLLLTDKERCLMIRPLSLQDQQTFARSVGLKWRKVGRSLQRSCRALRDPVLDSLAYE
YEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLANPDGGLA
Download sequence
Identical sequences F7BI42
9796.ENSECAP00000011430 ENSECAP00000011430 ENSECAP00000011430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]