SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011537 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011537
Domain Number 1 Region: 403-546
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 299-404
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-35
Family Second domain of FERM 0.00000386
Further Details:      
 
Domain Number 3 Region: 219-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-26
Family First domain of FERM 0.000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011537   Gene: ENSECAG00000012838   Transcript: ENSECAT00000014430
Sequence length 746
Comment pep:known_by_projection chromosome:EquCab2:10:77117492:77224096:-1 gene:ENSECAG00000012838 transcript:ENSECAT00000014430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKEPDQLGADAAQEKPKEAAENQQPQPSDAEEEKGPQTSPTAESQSSPR
RQKREKEPSDSRGISRFLPPWLKKQKSYNLIVAKDGGEKKEPTQAVVEEQILDKEEPFPE
EERQAKGSAEVAAQRKQQETKVDVKEEKPAVRGPETQRISVFRQQPAEEVSKEREEKVKE
VQDDKSEEAARRETKEVQTNELKAEKASQKAPKKTKTVPCKVTLLDGSEYSCDLEKRAKG
QVLFDKVCEHLNLLEKDYFGLLFQENPEQRNWLDPAKEIKRQLRNLPWLFTFNVKFYPPD
PSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPKEHGSNDLSD
FQFAPNQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIK
LGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRA
AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFE
RTSSKRASRSLDGAPIGDVDQSLMKDFPGPARDVSAYGPGVISPAVAEDGDGRRDVRSPA
RAPHVQLIEGKPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGD
SGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIRE
AREQHPDMSVTRVVVHKETELEEGEE
Download sequence
Identical sequences F7AQH1
ENSECAP00000011537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]