SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011560 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011560
Domain Number 1 Region: 781-975
Classification Level Classification E-value
Superfamily vWA-like 7.42e-47
Family Integrin A (or I) domain 0.00063
Further Details:      
 
Domain Number 2 Region: 44-227
Classification Level Classification E-value
Superfamily vWA-like 1.39e-30
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1089-1145
Classification Level Classification E-value
Superfamily BPTI-like 4.36e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011560   Gene: ENSECAG00000013598   Transcript: ENSECAT00000014457
Sequence length 1147
Comment pep:known_by_projection chromosome:EquCab2:4:41122490:41298272:-1 gene:ENSECAG00000013598 transcript:ENSECAT00000014457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNRHFVFYLLLLPAFMNQTLYGQRKKGSKSNLLTRKNDLQDSTCFIDVVFIVDSSESSK
IVLFDKQKDFVDSLSDKVFQLTPVRSLKYDIKLAALQFSSSVQIDSPFSSWKDLQTFKQR
VKSMNLIGQGTFSYYAISNATRLLQREGRKDGVKVALLMTDGIDHPKNPDVQSISEDART
AGILFITIGLSTVVNEAKLHLISGDSSSEPIPLLNDPTLADKIRDRLDILFEEKCEHKIC
DCQKGDPGDPGPPGTHGNPGIKGERGPKGNPGDAQKGEPGERGPGGIRGYKGEKGERGEC
GKPGIKGDKGSPGPDGSKGPRGLQGISGPPGDPGLKGIQGNKGEPGPPGPYGPPGAPGIG
QQGIKGERGQEGRTGAPGPTGDGEPGQPGPRGPEGTPGERGLPGEGFPGPKGEKGAEGPI
GHQGLQGLSIKGDKGDLGPVGPQGPMGIPGIGSQGEQGIQGPIGPPGPQGPPGQGSPGSK
GEVGQTGPPGPRGPVGIGVQGPKGEPGSIGLPGHPGVPGEDGAAGKKGEAGLPGTRGPEG
LPGKGQPGPKGDEGKKGSKGNQGQRGFPGPEGPKGDPGVMGPFGMPGASNPGPPGPKGDR
GGPGVPGFKGEPGISIRGPKGAQGPRGPVGAPGPKGDSYPGAAGPRGLPGPPGPMGLRGV
GDTGAKGEPGVRGPPGPTGPRGIGTQGPKGDIGQKGLPGPPGPPGYGLQGTKGEQGPQGF
PGPKGTTGRGLPGQKGEHGERGDVGKKGERGEIGEPGSPGKQARRPKGDLGLTKEEIIKL
IFEICGCGPKCKETPLELLFVIDSSESVGPENFQIIKNFVKTLTDQVALDLDTARIGIIN
YSHKVEMVAHLTQFSSKDDFKLAVDNMQYLGEGTYTATALHAANHMFEAARPGVKKVALV
ITDGQTDTRDEKNLTEVVKNASDASVEIFVIGVVKRNDPNFEMFHKEMNLIATDPDSEHV
YQFDDFITLQDTLKQKLFKKKCEDFDSYLIQVLGSPLLQPGFGTSGEERSESTPEPQSEI
SESFSVPRTQDKEKEPLEPTWADSMAPTPSSEAATTQGALLSPSEDGAEGLETRTPSPIL
ILPLEKLVYKDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKEC
QEVCIQG
Download sequence
Identical sequences F7AL05
ENSECAP00000011560 9796.ENSECAP00000011560 ENSECAP00000011560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]