SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011592 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011592
Domain Number 1 Region: 1311-1419
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-33
Family PDZ domain 0.00000453
Further Details:      
 
Domain Number 2 Region: 1718-1894
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.45e-28
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 3 Region: 1474-1563
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-17
Family PDZ domain 0.0096
Further Details:      
 
Domain Number 4 Region: 698-770
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-16
Family PDZ domain 0.025
Further Details:      
 
Domain Number 5 Region: 574-686
Classification Level Classification E-value
Superfamily PDZ domain-like 3.06e-16
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 6 Region: 1574-1638
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000696
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 7 Region: 2-89
Classification Level Classification E-value
Superfamily DEATH domain 0.000000188
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011592   Gene: ENSECAG00000013283   Transcript: ENSECAT00000014496
Sequence length 1897
Comment pep:known_by_projection chromosome:EquCab2:1:65017459:65144609:-1 gene:ENSECAG00000013283 transcript:ENSECAT00000014496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLL
AKERDHFQDLRAALEKTQPHLLPILYLNGVAGPPQPAEGAGTTGKAPSPPPLLTDRQVNE
KVENLSIQLRLMTRERNELRKRLAFATHGTTFDKRPYHRLNPDYERLKIQCVRAMSDLQS
LQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTQLKDDVNMLRRENGQLLRERNLLQQS
WEDMKRLHEEDQKEIGDLRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRY
SEKVAIHNSDLSRLEQLEEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELN
KATAQNKDLQWEMELLQSELTELRTTQVKTAKESEKYKEERDAVYSEYKLIMSERDQVIS
ELDKLQTEVELAESKLKSSTSEKAAASEEMEVLRQIKDTVTMDAGRANKEAEILRKQCKA
LCQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRS
LDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFE
RETEDIDLKALGFDMAEGVNEPCLPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLI
NKDKKQAIKALLHGEGAINMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVV
PGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSG
QNIFENIKDSDKMLSFRAHGPEVQAQNKRNLMQHNNSTQTDIFHADRLEDKKELGPPGGS
SSFLHKPFPGGAFPVSPQACPSTSERSLSSFRSDTSGERGYGLVDVRSRRLLLPFENEAG
PCGVTEAPLGKAESENANSGGTWPKAMLSSTAGPEKLSVYKKPKQRKSIFDPNTFKRPQT
PPKIDYLLSGPGPAHSPQPSKRVGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPS
TSPPSALPVDVDPGEPMHASPPRKARVRIASSYYPEGDGDSSYLPAKKSCDEDLTSQKMD
ELGQKRRRPKSAPSFRPKLAPVVIPTQFLEEQKSMPASGELSPELQEWSPYSPGHSSRHS
NPPPYPSRASVGTVPRSMTPSTTVSSILRNPIYTVRSHRVGPCSSPPVPREVGPQGLHAS
VQHQGRLSLDLSHRACSDYSEMRASHGSNSLPSSARLGSSSNLQFKAERIKIPSTPRYPR
SVVGSDRGSLSHSECSTPPQSPLNIDTLSSCSQSQASASTLPRIAINPAALGERRKDRPY
VEEPRHVKLQKGSEPLGISIVSGEKGGVYVSKVTGGSIAYQAGLEYGDQLLEFNGINLRS
ATEQQARLIIGQQCDTITILAQYNPHMHQLSSHSRSSSHLDPANIHSTLQGSGATTPEHP
SVIDPLMEQDEGPGTPLAKQSTPSSRMVGDANKKTPEPRVVFIKKSQLELGLHLCGGNLH
GVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDVRNKTVEEVYVEMLKPKDGVRLKVQFRP
EEFAKVKGLPGDSFYIRALYDRLAEVEHELSFKKDDILYVDDTLPQGTFGSWMAWQLDEN
AQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNATAKTLSAAARRSFFRRKHKHKRSGSKD
GKDLLALDTFSNDSIPLFEGKVVLAYQRVQRVDCSSLRPVLILGPLLDVVKEMLVNEAPG
KFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDIAP
HAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLKDKVTQRHSKEQFETAQKIEQEYSR
YFTGIVQGGALSSICTQILAMVNQEQDKVLWIPACPL
Download sequence
Identical sequences F7AF02
ENSECAP00000011592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]