SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011692 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011692
Domain Number 1 Region: 70-121
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000419
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 27-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000549
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011692   Gene: ENSECAG00000014041   Transcript: ENSECAT00000014615
Sequence length 134
Comment pep:known_by_projection chromosome:EquCab2:22:34230815:34234938:-1 gene:ENSECAG00000014041 transcript:ENSECAT00000014615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWSLLLLVAFLALGSQLPAALGSRKREKLGGCPPDDGPCLQLVPDQCMDDSQCPSRKK
CCYQACYRQCVRLVSVKQGSCPKDPLRCLSPIQHLCHQDSDCRGSSRCCLGACGRDCRNP
VKGMVPVHLGQVLS
Download sequence
Identical sequences F6ZLE2
ENSECAP00000011692 9796.ENSECAP00000011692 ENSECAP00000011692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]