SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011964 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011964
Domain Number 1 Region: 67-116
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000000392
Family Elafin-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011964   Gene: ENSECAG00000014295   Transcript: ENSECAT00000014936
Sequence length 117
Comment pep:known_by_projection chromosome:EquCab2:22:34255403:34257021:1 gene:ENSECAG00000014295 transcript:ENSECAT00000014936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSSFLILVVFLVLGTLAAQAAVAGVPPKGQGTDKGHALVKGRDPVRGQDPVKGQDSVK
AQSLRKVPIVAKPGLCPKILIRCAMLNPPNRCLRDTECPGAKKCCVGSCGRVCMDPK
Download sequence
Identical sequences F6ZRN7
XP_001503236.1.31192 XP_008527850.1.77740 XP_014715343.1.49734 ENSECAP00000011964 ENSECAP00000011964 9796.ENSECAP00000011964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]