SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012109 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012109
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.24e-48
Family RUNT domain 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012109   Gene: ENSECAG00000014360   Transcript: ENSECAT00000015100
Sequence length 332
Comment pep:known_by_projection chromosome:EquCab2:2:30292512:30318899:1 gene:ENSECAG00000014360 transcript:ENSECAT00000015100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVG
RSGRGKSFTLTITVFTNPTQVATHHRAIKVTVDGPREPRRHRQKLEDQTKAFDRFGDLER
LRMRVTPSTPSPRGSLSTTSHFSSQAQTPIQGTSDLNPFSDPRQFDRSFPALPTLTESRF
SDPRMHYPGAMSATFSYSATPSGTSISSLGMAGMPATSRFHHTYLPPPYPGAPQNQSGPF
QANPGPYHLYYGASSGSYPFSMVAGSSGGGDRSPTRMLASCTSSAASVAAGNLMNPSLGG
QSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Download sequence
Identical sequences F7CDF2
ENSECAP00000012109 9796.ENSECAP00000012109 ENSECAP00000012109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]