SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012163 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012163
Domain Number 1 Region: 93-284
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.57e-72
Family T-box 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012163   Gene: ENSECAG00000014426   Transcript: ENSECAT00000015160
Sequence length 521
Comment pep:known_by_projection chromosome:EquCab2:X:59663128:59671261:1 gene:ENSECAG00000014426 transcript:ENSECAT00000015160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSRANAFSVEALVGRPSKRKLQDPREEAQLELLEKEGGEEEERRSGAEGKTCEQPEK
RPKTEPSATAFSSCGGGSGDRSSGECLEEKDAIQVELQGSELWKRFHDIGTEMIITKAGR
RMFPSLRVKVKGLDPGKQYFVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHSCITPRFYIH
PDSPCSGETWMRQIISFDRVKLTNNEMDDKGHIILQSMHKYKPRVHVMEQDSRIDLSRIQ
SLPAEGVKTFTFKETEFTTVTAYQNQQITKLKIDRNPFAKGFRDPGRNRGVLDGLLETYP
WRPSLTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPPCSPPTFHLPTSSLGMPC
PEVYLQDINLPLCYKICPTNFWRQQHLVLPAPERLASSNSSQCLAPLMMEVPMLSSLGVT
NSKSDSSADFSGQCLQAPNSANQMLYGLQAPGNILSPYPIAQEAIGCSFHPSYGFYRYNF
SMPSRLINADNQLKVNDNRQVSFREGKCSHGHWYPTINHCL
Download sequence
Identical sequences F7C758
9796.ENSECAP00000012163 ENSECAP00000012163 ENSECAP00000012163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]