SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012175 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012175
Domain Number 1 Region: 308-402
Classification Level Classification E-value
Superfamily Immunoglobulin 7.15e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000101
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 224-288
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000212
Family Pre-dockerin domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012175
Domain Number - Region: 492-550
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00255
Family Carboxypeptidase regulatory domain 0.056
Further Details:      
 
Domain Number - Region: 107-173
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.0235
Family Vitelline membrane outer protein-I (VMO-I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012175   Gene: ENSECAG00000014515   Transcript: ENSECAT00000015173
Sequence length 1184
Comment pep:known_by_projection chromosome:EquCab2:1:127154784:127166038:1 gene:ENSECAG00000014515 transcript:ENSECAT00000015173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGTKAWVFFFLVLEFTSVLGRQTMLIQSVRRVQPGKRTLSIFAKPADSPEIPGEWTTWF
NIDHPGGEGDIERLDAILFYYGDRVCARPLRLEARTTNWTPAGRTGQVVRGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGHTGVQTRTRTCLAE
TVSLCNEAAEEGRHCMDQACSACDMTCSMGQVNADCDACMCQDFVLRGAVSLPGGAPASG
ATVYLLTKTPKPLTRTDSSGRFRVPGLCPDGKSILKITKAKFAPIRLTMPKTRLKAVTIN
AEFKRAETPYIVMNPETKARRAGQSVSLCCKATGKPSPDKYFWYHNGTLLDPSRYKHESK
LVLRNLKQDQAGEYFCKAQSDAGAVKSKVAQLTVIGPDETPCNPTPESYLIRLPHDCFQN
ATNSFYYDVGHCPVKTCAGQQDNGIRCRDAVENCCGISKTEEREIQCSGYTLPTKVATEC
SCQRCTETRSIVRGRVSAADNGEPMRFGHVYMGSNRVSMTGYKGTFTLHVPQDTERLVLT
FVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRRKEPIILDAMETNIIPLGEVDGEDPMGE
LEIPSKSFYRQNGEPYTGKVKASVTFLDPRNISTATAAQSDLNFINDEGDTFPLRTYGMF
SVDFTDEATSESLNAGKVKVHLDSTQVKMPEHVPTMKLWSLNPDTGLWEEEDDFKFESQR
RKRREDRTFLVGNMEIRERRLFNLDVPESRRCFIKVRAYRSERFLPSEQIQGVVVSAINL
EPRAGFSSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELEAVESSP
KFNPNAIGVPQPYLNKLKYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLR
ACEQAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKI
VGPLEVNVRSRNMGGTHRQTVGKLYGIRDVKSTRDRDQPNVSAACLEFKCSGMLYDQDRV
DRTLVKIIPQGSCHRASVNSMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVT
DQDPRTAKEIALGRCFDGTSDGSSRVMKSNVGVALTFNCIERQVGRQSAFQYLQSTPTRP
PTVSTIRGRLPSRRQQRSSRAVQRQRRGVASLRFPGAAQQPLKN
Download sequence
Identical sequences F7C2J3
9796.ENSECAP00000012175 ENSECAP00000012175 ENSECAP00000012175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]