SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012458 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012458
Domain Number 1 Region: 30-76
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000209
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 82-131
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000667
Family Elafin-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012458   Gene: ENSECAG00000014790   Transcript: ENSECAT00000015495
Sequence length 133
Comment pep:novel chromosome:EquCab2:22:34309663:34311430:1 gene:ENSECAG00000014790 transcript:ENSECAT00000015495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSRLMTFVVLLALGILTSWAVEGASKEKAKHGVCPFVPPTICFVYEPPECQSDWQCPK
KQKCCRALCGIKCVEPEDPSKPVKVNPGKCPVVTGRCKTSNPTDYCLNDGHCLFGDKCCK
GVCGKSCVKPVKG
Download sequence
Identical sequences F7C1A1
ENSECAP00000012458 ENSECAP00000012458 9796.ENSECAP00000012458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]