SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012602 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012602
Domain Number 1 Region: 504-576
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.4e-19
Family Complement control module/SCR domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1407-1479
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-18
Family Complement control module/SCR domain 0.00018
Further Details:      
 
Domain Number 3 Region: 954-1026
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.0000677
Further Details:      
 
Domain Number 4 Region: 565-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.08e-16
Family Complement control module/SCR domain 0.0000468
Further Details:      
 
Domain Number 5 Region: 1015-1083
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.08e-16
Family Complement control module/SCR domain 0.0000468
Further Details:      
 
Domain Number 6 Region: 54-125
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.15e-16
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 7 Region: 369-438
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.00055
Further Details:      
 
Domain Number 8 Region: 820-888
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 9 Region: 247-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.34e-16
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 10 Region: 1723-1792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000136
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 11 Region: 1798-1866
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 12 Region: 1148-1209
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000661
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 13 Region: 114-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000709
Family Complement control module/SCR domain 0.0000485
Further Details:      
 
Domain Number 14 Region: 1601-1663
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000119
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 15 Region: 185-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000189
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 16 Region: 1468-1536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 17 Region: 1090-1153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000361
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 1270-1339
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000681
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 19 Region: 640-703
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 1667-1734
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 697-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000216
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 22 Region: 312-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 1855-1917
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 24 Region: 1542-1605
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 25 Region: 1214-1281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000131
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 764-831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000862
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 27 Region: 444-509
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000054
Family Complement control module/SCR domain 0.00022
Further Details:      
 
Domain Number 28 Region: 1347-1413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000202
Family Complement control module/SCR domain 0.00018
Further Details:      
 
Domain Number 29 Region: 894-958
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000695
Family Complement control module/SCR domain 0.0000819
Further Details:      
 
Domain Number 30 Region: 12-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000405
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012602   Gene: ENSECAG00000014292   Transcript: ENSECAT00000015658
Sequence length 1987
Comment pep:novel chromosome:EquCab2:5:30509359:30645075:1 gene:ENSECAG00000014292 transcript:ENSECAT00000015658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFAKPKIQSDQSEFAVGTSWEYECLPGFIKSSFFTTCLETSEWSDAQQFCKRKSCMSPRE
LLHGSVHTPMGIVFGSTITYSCDEGYRLIGDSSATCISDNIVTWDSDMPFCEIIPCESPP
AISNGDFYSSSREHFYYGMVVTYECHIGQNGKKLFDLVGEPSIYCTSKDNRIGIWSSPPP
QCITVVKCPVPEVENGIMESGFRRSFSLNDTVMFKCKPGFTMKGSNIVWCQPNSKWNPPL
PKCFKGCLLPPDIANGSYSKMDKEFFQIGQKVSYSCEPGYTLIGTNPVQCTSLGTWSPTA
PRCEAKSCDVIPNQLLNGRVVAPPSLRLGAEVSFVCDKGYRLNGKSSSQCVVEGMKVLWN
NKFPVCEQILCPAPPPILHGRHTGSSSVNVPYGSRVTYTCDSDPEKGVNFILIGKNTIYC
TADSQKTGTWSGPAPRCELSGCQCKAPEWLPFAKPTTLTEENEFPIGTSLKYKCRPGYYQ
REFSITCLPNSVWSTAENICKRKQCRSPPEPTNGKMVVNGDIQFGSTVNYLCNEGYRLIG
HSSTTCIISGNTVIWDNEAPVCESIPCGPPPAIANGDFISTNREYFPYGTVVTYYCNPRE
RRIKLFHLIGQPSIYCTSLDNQVGVWSGPPPQCIVPNTCTPPDVENGIRVSENRSFFPLN
EIVEFRCQPGFVMKGPSSVRCQAQNKWVPELPSCSRACQPPPEIPYGKHTPSNKDNFSPG
QEVFYSCEPGYDLRGAASLSCTPQGDWRPEAPRCAGKSCADFLDQLPNGRILFPLNLQLG
AKVSFVCDEGFQLKGNSASHCILVGMESLWNSSVPVCEQILCPNPPDILNGRHTGKPLEV
FPFGKEVTYTCDPHPYRGMTYNLTGESTIRCTSDSQGNGIWSSPAPRCVLPGYCNSPDHF
QFAKLKIQTNESVFPIGTSLKYECRPEFYRRSFSITCLENLTWSNAKDVCKRESCKTPPD
PMNGVVHVDTDTQFGSRINYSCNRGYRLIGQSSAKCIISGNTVSWETEPPICERIPCGPP
PAIANGDFISTNREYFPYGTVVTYYCNPRERRIKLFHLIGQPSIYCTSLDNQVGVWSGPP
PQCIVPNTCTPPDVENGIRVSENRSFFPLNEIVEFRCQPGFVMKGPSSVRCQAQNKWVPE
LPSCSRVCQPPPKILHGRHIASNKDEFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPE
APRCAVKSCADFIDQLPNGRILLPLNFQLGAKVSFICDEGFHLKGSSASYCILVGMESLW
NNSVPVCEQIFCPNPPAILNGNHTGTSLGDIPYGKEISYTCDLHPDRGMTFNLIGERTIR
CTSDSQGNGIWSSPAPRCELSGPAGYCKAPEQFPFAKPTTLTDESEFPIGTSLNYECSPG
YFENMFSITCLENLVWSSAEDICRRKSCGTPPEPFNGMVHINTDTQFGSTVNYSCNEGYR
LIGSLSAACLLSGNNVTWDKEAPLCESISCEPPPAISNGDYYSSNGNVFQYATVVTYRCL
TGPDGEKLFDLVGEQSIFCTSKDNQLGVWSSPPPQCVSASKCTTPEVENGIRLSGNKSLF
SLSEIVRFRCQPGFVMKGSNVVQCWANNTWVPELPSCSRACQLPPEIPHGKHTPNNKDDF
SPGQEVFYSCEPGYDLRGAASLRCTPQGDWSPEAPRCAVKSCADFLDQLPNGRVLFPLNF
QLGAEVSFICDEGFRLKGSSTSRCVLVGMKSLWSSSVPVCEQIFCPNPPAILNGRHTGTS
LGDIPYGKEITYTCDPHPVRGMTFNLVGESTIRCTSDSQGNGFWSSPAPRCEPSGSAACP
HPPKIHNGHKIGGRASPYLPGMTVTYTCDPGYLLVGNAFIFCTHLGTWSQSDHYCKEVKC
SLPQFMNGIQKEMKIKNIYHYGDNVTLECEDGYSLKGSPQSQCQADNTWDPPLAICTSRP
RDALIVGIFFGMIFFIVPIIISCWMVLKRKKGNNTDGKSKEVIIHLHPQQGNCVQPQSLQ
TNQENGR
Download sequence
Identical sequences F7D7E9
ENSECAP00000012602 9796.ENSECAP00000012602 ENSECAP00000012602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]