SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012699 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012699
Domain Number 1 Region: 429-564
Classification Level Classification E-value
Superfamily TIMP-like 5.49e-32
Family Netrin-like domain (NTR/C345C module) 0.033
Further Details:      
 
Domain Number 2 Region: 205-301
Classification Level Classification E-value
Superfamily Immunoglobulin 7.29e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 382-434
Classification Level Classification E-value
Superfamily BPTI-like 5.39e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 4 Region: 320-377
Classification Level Classification E-value
Superfamily BPTI-like 7.95e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 120-170
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000013
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 34-85
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012699   Gene: ENSECAG00000015064   Transcript: ENSECAT00000015764
Sequence length 573
Comment pep:known_by_projection chromosome:EquCab2:11:26441683:26446126:1 gene:ENSECAG00000015064 transcript:ENSECAT00000015764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALGCRRFWFCWGQVAVLLLLLGVPPRGLALPPIRYSHAGICPNDMNPNLWVDAQSTCK
RECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSEC
DIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPN
TSPPPPETTVRPTTASPETPGLDMVAPALLNHPVHQSVSMGETVSFLCDVVGRPRPEITW
EKQLEDRENVVMWPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTARNAAGVLRADFPLS
VVRGAPAAASVEGSVNATAFPAAECLQPPDSEDCGEEQTRWHFDAQANNCLTFPFGHCHR
NRNHFETYEACVLACMSGPLAVCSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEGNG
NNFESREACEESCPFPRGTPRCPACKPRQKLVTSFCRSDFVILGRVSEVTEEPDSGRALV
TVDEVLKDEKMGLKFLGREPLEVTLLHVDWTCPCPNVTVGDTPLIIMGEVDSGMAMLRPE
SFVGASSSRRVRKLREVMHKKTCDVLKEFPGLQ
Download sequence
Identical sequences F7CRY5
XP_001499830.1.31192 ENSECAP00000012699 ENSECAP00000012699 9796.ENSECAP00000012699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]