SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012804 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012804
Domain Number 1 Region: 17-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.14e-50
Family DBL homology domain (DH-domain) 0.0000378
Further Details:      
 
Domain Number 2 Region: 174-320
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 434-553
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-30
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 336-442
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-26
Family DEP domain 0.0033
Further Details:      
 
Domain Number 5 Region: 618-701
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000486
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012804   Gene: ENSECAG00000014676   Transcript: ENSECAT00000015883
Sequence length 1585
Comment pep:known_by_projection chromosome:EquCab2:22:36998574:37106417:-1 gene:ENSECAG00000014676 transcript:ENSECAT00000015883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLHRIRQNVTDAVEKGLTEENVKILFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGN
VFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLL
SPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQL
QSHIEGWEGSNLTDICTQLLLQGPLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKS
TKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCM
AKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMISEKGEKLYHMMMSKKVNLIKDRRR
KLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYR
FRYDDGTYKARSELEDIMSKGVRLYCRLHSLSTPVIKDRDHHLKTYKSVLPGSKLVDWLL
AQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEGTSSKNKQLRN
DFKLVENILAKRLLVGAELSCCQFLLEENILPVGASSRPAFMAQWMAGLQVGRKIYSINE
DLVFLRPFAEVESLNQSFCSRRPLRLLVATKAKEIIKVPDHPEALCFQIRGAAPPYVYAV
GRGSEAAAAGLCAGQCILKVNGNNVMGAGATEVLEHFQAFRSHREDALGLYQWVYHTHED
AQEARASQEAPGEDLDGDGAREEDQPDSAFPLLSLSPQLSLHEDGPVVSLTVDNVPLEHG
VVYEYVSTAGVKCHVLEKIVEPRGCFGLTAKILEAFATDDSVFVQNCGRLMALNNNIRTM
SHYEFLNICDTKLESIGQRIARYREFAVQLKSRVSPPFKQAALEPHSLCGLDFCPTNCHV
NLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPAWKCLP
AVEGDLQRHGPSDSGFGPASGAPGQEDRGLSFLLKQEDREIQDAYLQLFTRLDVALKEMK
QYVTQINRLLSTITEPTSGGSCDLPSAEEASSPPLVSEESEMDRTEHGGSKKVCFKVSEE
DQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDK
QDKLHGCLEHLFNQVDSIHMLLKGPVMSRAFEETKHFPMDHSLQEFKQKEECTVRGRNLI
QISIQEDPWNLPSSIKTLVDDIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAA
VCTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPATAKEERT
MLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALRIVFYLDSYHFSKLPSR
LENGASLRLHTVLFTKALENVEGPPPPGSQAAEDLQQEINAQSLEKVQQYYRKLRAFYLE
RSNLPTDASTTVVKIDQLIRPINALDELCRLMKSLVHPKPGAGASLGAGLIPVSSELCYR
LGACQIAMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKNL
RVKDQMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences F7DWA8
ENSECAP00000012804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]