SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012832 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012832
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000222
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 2 Region: 23-70
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000667
Family Elafin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012832   Gene: ENSECAG00000015239   Transcript: ENSECAT00000015916
Sequence length 178
Comment pep:known_by_projection chromosome:EquCab2:X:4970012:4981190:-1 gene:ENSECAG00000015239 transcript:ENSECAT00000015916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEVDNECSGVKKCCSN
GCGHTCQVPKTLYKGVPLKPRKELRFTELQSGQLEIKWSSKFNISIEPVIYVVQRRWNYG
IHPSEDDATHWQTVAQVNERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSK
Download sequence
Identical sequences F7DS25
9796.ENSECAP00000012832 ENSECAP00000012832 ENSECAP00000012832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]