SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012883 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012883
Domain Number 1 Region: 16-313
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.19e-79
Family Pancreatic carboxypeptidases 0.000000000798
Further Details:      
 
Domain Number 2 Region: 314-407
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.92e-23
Family Carboxypeptidase regulatory domain 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012883   Gene: ENSECAG00000015198   Transcript: ENSECAT00000015977
Sequence length 443
Comment pep:known_by_projection chromosome:EquCab2:6:83894627:83955892:-1 gene:ENSECAG00000015198 transcript:ENSECAT00000015977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCSRLWLGLLLPLAAALDFRYHHQAEMEAFLKAVAQNYSSITRLHSIGKSVRGRNLWVL
VVGRFPKEHRVGIPEFKYVANMHGDETVGRELLLHLIDYLVTNDGKAPEITRLINSTRIH
IMPSMNPDGFEAVKKPDCFYSNGRENNNYYDLNRNFPDAFESNNVSRQPETVAVMEWLKT
ETFVLSANLHGGALVASYPFDNGVPATGTLHSRSLTPDDDVFQYLAHTYASKNANMKKGD
HCKNKMNFPNGITNGYSWYPLKGGMQDYNYIWAQCFEITLELSCCKYPPEEKLPFFWNFN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNAIVEVQDRKHICPYRTNKFGEYYLLLLPGSY
IINVTVPGHSPHLTKVIIPGKSQNFSALKMDILLPFRGQLDSIPESNPSCPMTPLYSDLP
SHSAATKPGLFLFLVTLFHLLFK
Download sequence
Identical sequences F7DMA1
ENSECAP00000012883 ENSECAP00000012883 XP_001917091.1.31192 XP_008529261.1.77740 9796.ENSECAP00000012883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]