SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013176 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013176
Domain Number 1 Region: 26-187
Classification Level Classification E-value
Superfamily PR-1-like 2.88e-52
Family PR-1-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013176   Gene: ENSECAG00000015592   Transcript: ENSECAT00000016314
Sequence length 222
Comment pep:known_by_projection chromosome:EquCab2:28:3517946:3556726:1 gene:ENSECAG00000015592 transcript:ENSECAT00000016314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRKKLNCLWTLSLCLVASKSLPKVPSITDQSFIDACVKSHNEMRGKVDPPAANMKHMT
WDEGLAQIAEAWTKKCKFQHNTCLSKSYECHPAFQFVGENMWLGGFRIFTPKSAVVAWCN
ENKFYDINSPSCSRVCGHYTQVVWANSYKLGCAVRICPNLRGAETAVFVCNYGPAGNIRN
VIPYTKGASCSMCAAGDTCAKKLCHNKERDKLQKYPNWKPPG
Download sequence
Identical sequences F6TDU6
ENSECAP00000013176 ENSECAP00000013176 9796.ENSECAP00000013176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]