SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013201 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013201
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily PR-1-like 3.53e-31
Family PR-1-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013201   Gene: ENSECAG00000015628   Transcript: ENSECAT00000016343
Sequence length 236
Comment pep:known_by_projection chromosome:EquCab2:28:3588038:3615319:1 gene:ENSECAG00000015628 transcript:ENSECAT00000016343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTWDVALSRTARAWGKKCVFEPNTHLEELRMAHPKFNGIGENMWVGPENEFTASIAIRS
WYAERKKYHFENDSCLDDCSHYIQLVWDRSYKVGCAVTPCSRIGPIRHAAIFICNYAPGG
ALTRRPYKPGLICSQCSRYDRCTDFLCSNAERDQAIYYRYWYPRWEVPRPVVCDPLCIFI
FFLRVLSFSLCATVVLMIQSQFPNILLEEQMLSTPEVNEVEPEKEEEEEEEEDKEK
Download sequence
Identical sequences F6VKL2
ENSECAP00000013201 ENSECAP00000013201 9796.ENSECAP00000013201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]