SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013394 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013394
Domain Number 1 Region: 134-299
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000232
Further Details:      
 
Domain Number 2 Region: 313-436
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-20
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 428-510
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000158
Family PDZ domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013394   Gene: ENSECAG00000015516   Transcript: ENSECAT00000016581
Sequence length 519
Comment pep:known_by_projection chromosome:EquCab2:1:107755275:107863573:-1 gene:ENSECAG00000015516 transcript:ENSECAT00000016581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSMTSITSAGEASPEHGLVRGPEPGPGDSTEACLPGEASHGPSRHEGRPKSLNLPSET
KHPGDPQRGFKTKTRTPEERPKWPQEEVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVAS
FPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKA
AKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLM
ARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRA
NGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGS
ILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLN
IVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVA
TAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences F6TS93
ENSECAP00000013394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]