SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013406 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013406
Domain Number 1 Region: 628-674,989-1093
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-29
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 1116-1217
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-21
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 
Domain Number 3 Region: 897-987
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013406   Gene: ENSECAG00000015785   Transcript: ENSECAT00000016595
Sequence length 1238
Comment pep:novel chromosome:EquCab2:14:66782364:66878303:1 gene:ENSECAG00000015785 transcript:ENSECAT00000016595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGERQPANQACQKNIKDLEKEVKGDTSKPVFHQTGTLGKSKENRDERTSASMNGKHYSPF
LPKDKKQLPADSKINREKENDDPSSSISHQLEKVLPVVMFNDCEESLSGKITLQDFSNTV
EAFKPAKGKIITEVKCGAFNVQIEIKNKFFCKTGTQFPTKKRCPKCYQRYSVRHIQRCSV
SRSCSSKYKNMRVEELKAEVPSKSKGEIARTESPSLKVSIVGKEIKVKYVSKKQNILINI
IHSKRRGKIAKCRNISSDHTTKECSRFSAQSDIRHPEKWQLENKRQSSDSLHVSPPFVFA
VQKEENVDTVAVSLCSTPEGEKNKPDTLSSVWDDCEVESAISHQNDFKISQNTPKKKHFS
DSEAILSNILPTSQDTLKTTSLIDTDLSKIPFEDSKDMDREKKLIFDIPENITSDSYIQQ
STEGINNLPNTITDIVPVQDGKGSSFCSSSLSVQLMGDKAANVYCKGSKMPSAHCCENSN
SSSFPSSQNALKSSTSLSPSHWATRHSEPKETPRDTLSFKHCAEYLKGYEEERVEVTDRD
SNKATLHTDSCAKAPQLLEMKSPPCATLSPASSRSHSAGSPLNHDSHSTEEWGHTEPQAS
YPETAATSKTKVPVMTLITYELEQRLIIQNDKDTVYSNCPMGMKNPKEPPSSLGNVEKDK
FQIMPMVKNACHRDFEDLSDENHDEVCSQVDFLNPAEFSAAVCATDNLFLTEKTLTNDAD
QYGNQDEISLALTSFKQEAAENQRIASTKPNSEGDKNDPKETSYHQIDILLSPQKQKALK
DWNWEINSLRKLSQELVPGGTRSSDGSQEEAIDQWARRRQQFKDGKRCSSAGGSSFASNI
TEGSVTSEDGCSVDFGFRVDIEEKGFYTENFHSAAWVFRGDDGNPEDSPRCLSKKPRPVA
VRERTVRLFKGTGDYPWGFRIQFSKPIVVTEVDANSAAEEAGLQIGDVVLAVNGTEVTSA
EHAEAVQLARKGPDILTLVVGSDISRCPNTPWPTCRGYLHKRTHSGFVKGWRKRWFVLKH
DGCLHYYRHKKDEGKSLPLEVVKLEGAEVGIDHSLGKPFVFNCVPQSGKRTFCLCATSNQ
EMKRWLEAMDKAVHPVRQNHVWEDVTLHNSSLPPLAIKNPECLGLLHQLDRSTDMWVQHY
CILKDGCLYFYSSIRSTQASGGLYLQGYRVNEQILSFKQSVIELKPPSEEFKTFYFCAEN
KTENQRWITALKMSIKKWLPLHQAIQDFMNRPLEETRM
Download sequence
Identical sequences F6W5R4
ENSECAP00000013406 9796.ENSECAP00000013406 ENSECAP00000013406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]