SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013416 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013416
Domain Number 1 Region: 25-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.69e-47
Family Phosphoribulokinase/pantothenate kinase 0.0000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013416   Gene: ENSECAG00000015649   Transcript: ENSECAT00000016606
Sequence length 282
Comment pep:known_by_projection chromosome:EquCab2:25:34054094:34059089:-1 gene:ENSECAG00000015649 transcript:ENSECAT00000016606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTGPEMASAGGGDCEGAAPETDRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVDHR
QRKLVILSQDSFYKVLTPEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGRTVEVPTY
DFVTHSRLPETTVVYPADVVLFEGILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVH
RGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDI
CKWHRGASNGRSYKRTFPEPGAHPGVLSSGKRSHLESSSRPH
Download sequence
Identical sequences F6W593
ENSECAP00000013416 9796.ENSECAP00000013416 ENSECAP00000013416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]