SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013459 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013459
Domain Number 1 Region: 369-534
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000232
Further Details:      
 
Domain Number 2 Region: 548-671
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 663-745
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013459   Gene: ENSECAG00000015516   Transcript: ENSECAT00000016655
Sequence length 754
Comment pep:known_by_projection chromosome:EquCab2:1:107755275:107817282:-1 gene:ENSECAG00000015516 transcript:ENSECAT00000016655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMANRKRQSTVSSMLDHRARPGPVPQGQEPESEDVELPLEEYVPKGLELAALRPESPLP
VEQGCHDHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPDDSYLEGMDCNGR
YLAHGTRHLETDECQEAVEEWTDSAGPHPHGHGDEGSPDYRDSHLPIPEDEASVLEAQDQ
EEGVHYCPSEEGYQDYYPTEANGNAGSTSPYRPRRGDGDLEDQEEDIDQIVAEIKMSLSM
TSITSAGEASPEHGLVRGPEPGPGDSTEACLPGEASHGPSRHEGRPKSLNLPSETKHPGD
PQRGFKTKTRTPEERPKWPQEEVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFV
AVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKK
KANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRM
PRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINP
EDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTV
ILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCP
PVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEK
IVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences F6VY08
ENSECAP00000013459 9796.ENSECAP00000013459 ENSECAP00000013459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]