SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013756 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013756
Domain Number 1 Region: 65-185
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000103
Family SEA domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013756   Gene: ENSECAG00000016224   Transcript: ENSECAT00000016988
Sequence length 230
Comment pep:novel chromosome:EquCab2:13:12374343:12380011:-1 gene:ENSECAG00000016224 transcript:ENSECAT00000016988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLGSMSVTIKAVFSSSLDPSMVKQAFLDQTLKASSHWPGATYQLVGEPVTGVQPSVYLGR
EKPSTSPSPHHFQLNFTITQPRGCVSTLFPFTVRSSSWSSATELSNTVKKDYSIRSHFSD
CQVLAFRSVSYSNHTRVDSLCNFSPLAQRLNRVAICEEFLKVTQNGTQLLSFDLEKNNVP
VDWYSPNRNDALTENSAFVSPYLPFWASILICFTRLPVLNTCLICSLLVS
Download sequence
Identical sequences F6V840
ENSECAP00000013756 ENSECAP00000013756 9796.ENSECAP00000013756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]