SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013758 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013758
Domain Number 1 Region: 78-129
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000034
Family Elafin-like 0.00051
Further Details:      
 
Domain Number 2 Region: 28-74
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000615
Family Elafin-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013758   Gene: ENSECAG00000016161   Transcript: ENSECAT00000016990
Sequence length 131
Comment pep:known_by_projection chromosome:EquCab2:22:34334247:34335813:-1 gene:ENSECAG00000016161 transcript:ENSECAT00000016990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSSLFPLVLLALGTLAPWTVEGARNASKAGACPPRRLAQCFRYEKAECQSDWQCQGEK
KCCRDTCGIKCLDPIAISKPVEKKPGNCPVPPGQCLMLDPPNHCETDGQCQGHLKCCTGM
CGKACISPVKG
Download sequence
Identical sequences F6V822
ENSECAP00000013758 ENSECAP00000013758 9796.ENSECAP00000013758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]