SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013883 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013883
Domain Number 1 Region: 53-108
Classification Level Classification E-value
Superfamily Zinc hairpin stack 7.59e-21
Family Zinc hairpin stack 0.0000241
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily CHY zinc finger-like 0.000000000000144
Family CHY zinc finger 0.0000404
Further Details:      
 
Domain Number 3 Region: 113-160
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000299
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013883   Gene: ENSECAG00000016109   Transcript: ENSECAT00000017128
Sequence length 231
Comment pep:known_by_projection chromosome:EquCab2:3:60590426:60608486:1 gene:ENSECAG00000016109 transcript:ENSECAT00000017128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCSIC
HLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGKHKCIENVSRQNCPICLE
DIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP
SEYQNMTVDILCNDCNGRSTVQFHILGMKCNICDSYNTAQAGGCRISLGQQ
Download sequence
Identical sequences F6TNA9
ENSECAP00000013883 ENSECAP00000013883 9796.ENSECAP00000013883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]