SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014297 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014297
Domain Number 1 Region: 477-626
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.8e-67
Family Ankyrin repeat 0.00000173
Further Details:      
 
Domain Number 2 Region: 2-204,239-264
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-55
Family BAR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 355-472
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000597
Further Details:      
 
Domain Number 4 Region: 230-347
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-20
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 5 Region: 972-1046
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-16
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014297   Gene: ENSECAG00000016246   Transcript: ENSECAT00000017582
Sequence length 1048
Comment pep:known_by_projection chromosome:EquCab2:9:71289520:71417310:-1 gene:ENSECAG00000016246 transcript:ENSECAT00000017582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFT
LDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEE
MEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIE
KLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKESRRDSQSRQGGYSMHQLQGNKEY
GSEKKGYLLKKSDGLRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKK
SFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIE
DVQRLPGNDVCCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSE
LLLAKNVGNNSFNDIMEANLPSPSPKPTRSSDMTVRKEYITAKYVDHRFSRKTCSSSSAK
LSELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFL
VQNCGNLDKQTALGNTALHYCSMYSKPECLKLLLRSKPTVDVVNQAGETALDIAKRLKAT
QCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDDLDDKPSPVKKERSPRPQSFCHSS
SISPQDKLSLPGFGTPRDKQRLSYGAFTNQIFVSSTDSPTSPTSEAPPLPPRNAGKGPTG
PPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPNKGAVPWGNDVGPS
SSSKTTNKFEGLSQQSSTGSAKTALGPRVLPKLPQKVALRKTETSHHLSLDKASVPPEIF
QKSSQLAELPQKPPPGDLPPKPTELAPKPPVGDLPPKPGELPPKPQLGDLPPKPQLSDLP
PKPQMKDLPPKPQLGDLLAKSQAGEVSPKALQPSEVPQKPHPVDLSPNVQSRDALQKQAS
EDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFNEGEVIVVTGEED
QEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences F6WU87
ENSECAP00000014297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]