SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014306 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014306
Domain Number 1 Region: 216-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000745
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 283-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000014306
Domain Number - Region: 339-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000151
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 392-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 40-96
Classification Level Classification E-value
Superfamily Sialidases 0.0167
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014306   Gene: ENSECAG00000016691   Transcript: ENSECAT00000017597
Sequence length 458
Comment pep:known_by_projection chromosome:EquCab2:5:60199585:60508875:-1 gene:ENSECAG00000016691 transcript:ENSECAT00000017597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKT
IELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTV
LEIICTEEYSTGYMTNSKIIHFEIKDRFAFFAGPWLRNMASLYGQLDTTKKLRDFFTVTD
LRIRLLRPAVGEIFVDELHLARYFYAISDIKVHGRCKCNLHATVCVYDNSKLTCECEHNT
TGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNT
VICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSVHDRCNGSGFCECK
TGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLR
CEEAGSCGSDSGQGAAPRCSPALLLLTALLGTASPLVF
Download sequence
Identical sequences F6YRZ2
9796.ENSECAP00000014306 ENSECAP00000014306 ENSECAP00000014306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]