SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014469 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014469
Domain Number 1 Region: 159-231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.33e-18
Family Complement control module/SCR domain 0.00013
Further Details:      
 
Domain Number 2 Region: 220-281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-16
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 3 Region: 33-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 4 Region: 95-169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014469   Gene: ENSECAG00000016667   Transcript: ENSECAT00000017789
Sequence length 512
Comment pep:known_by_projection chromosome:EquCab2:5:30816090:30832144:-1 gene:ENSECAG00000016667 transcript:ENSECAT00000017789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARRSAPTVLRLLGWLPVLLLLCPPAARGDCSHPPDVPNAQPTLGELTSFPKQTTVTY
KCDEGFVKVPGKPDSVVCLENDKWSEVAEFCNRNCDVPPRLPFASLQNPYRNQNYFPAGS
TVEYECRMGYRRDRSLSGTLTCLQNFTWSKPDEFCKKKACPTPGEIPNGHVKIQTDILFG
AAISFSCNTGYTLVGSSFSYCSLEGENVKWTDPLPECKEIACPSPPAIANGIILEQHDTY
IYRQSITYKCEKGFTLVGGNSIHCTVKDGQGEWSGPPPECKDSSQISKVTPAVQKPTTVD
VTATEAPSTPQKTSAKTSAVNVTATEAPSTPQKPTTIHSSATKFPLIPQRPTIVDIPATE
APSTPQKPTTIHSSATKFPLIPQKPSNVNIPATETPSTPQKPTAANVSATTAEKSPISNS
LSAETPPAAQNPIVANASATQFTPVTQRLNTAKASFTQSLPGTRKSTAVHAPVTKHVHTK
QRLTSAAHITATQNLAVPSTTTRFHTTSTSKG
Download sequence
Identical sequences F6XGE0
ENSECAP00000014469 ENSECAP00000014469 9796.ENSECAP00000014469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]