SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014483 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014483
Domain Number 1 Region: 2-239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.32e-57
Family BAR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 345-524
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.000000313
Further Details:      
 
Domain Number 3 Region: 212-316
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-16
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 4 Region: 677-732
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014483   Gene: ENSECAG00000016629   Transcript: ENSECAT00000017805
Sequence length 733
Comment pep:known_by_projection chromosome:EquCab2:2:84979896:85188896:-1 gene:ENSECAG00000016629 transcript:ENSECAT00000017805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETL
IKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQ
HFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINI
QNTRNRFEGTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCM
YRKAAKKFNIIPFEHRSGGKLGDGEVFYLKECTKRHTDSIDRRFCFDVEAADRPGVSLTM
QAFSEEERKQWLEALGGKEALFHSFNRAIVPRPEGSAQLDKMGFTILRKCISAVETRGIN
DQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSIDWEVKTITSALKQYLRSLPEPLMT
YELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVA
NLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTLPDATFPEPVSLSPSP
PNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDSPNPPKEDTPPSSLDSLSSPSPTTATVP
GPPGPDKNHLLADGGSFGDWTSTGTSQPRSCMVQWLNPQSPTTPSCNPAVRPPSPKSAPV
PLSPATVADKPPESVINRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNG
KRGLIPQNYVKLL
Download sequence
Identical sequences F6XBS8
ENSECAP00000014483 9796.ENSECAP00000014483 ENSECAP00000014483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]