SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014882 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014882
Domain Number 1 Region: 322-575
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.33e-109
Family STAT DNA-binding domain 0.000000000166
Further Details:      
 
Domain Number 2 Region: 136-321
Classification Level Classification E-value
Superfamily STAT 8.24e-63
Family STAT 0.00000000995
Further Details:      
 
Domain Number 3 Region: 576-714
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-43
Family SH2 domain 0.0000000921
Further Details:      
 
Domain Number 4 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.36e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014882   Gene: ENSECAG00000016439   Transcript: ENSECAT00000018255
Sequence length 770
Comment pep:known_by_projection chromosome:EquCab2:11:20610215:20637153:1 gene:ENSECAG00000016439 transcript:ENSECAT00000018255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
RVGYMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Download sequence
Identical sequences F6Z6Y4
ENSECAP00000014882 ENSECAP00000014882 9796.ENSECAP00000014882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]