SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014894 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014894
Domain Number 1 Region: 53-237
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.6e-79
Family T-box 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014894   Gene: ENSECAG00000017114   Transcript: ENSECAT00000018271
Sequence length 518
Comment pep:known_by_projection chromosome:EquCab2:8:18396028:18448361:1 gene:ENSECAG00000017114 transcript:ENSECAT00000018271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSD
DMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSNEPRALSTSSNLGSQYQCENGVSGP
SQDLLPPPNPYPLPQEHSQIYHCTKRKDEECSTTDHPYKKPYMETSPSEEDPFYRSSYPQ
QQGLSASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYGSCTVTTVQPMDR
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPG
SLQPSEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Download sequence
Identical sequences F6Z6Q0
ENSECAP00000014894 9796.ENSECAP00000014894 XP_014583084.1.31192 ENSECAP00000014894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]