SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014905 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014905
Domain Number 1 Region: 122-234
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-38
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 2 Region: 39-137
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-24
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 3 Region: 255-369
Classification Level Classification E-value
Superfamily PH domain-like 0.000000812
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014905   Gene: ENSECAG00000017294   Transcript: ENSECAT00000018283
Sequence length 474
Comment pep:known_by_projection chromosome:EquCab2:9:63422975:63646490:-1 gene:ENSECAG00000017294 transcript:ENSECAT00000018283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSAEAAGSGHPGGGRRAAPDSSAGVRTAFTDLPEQVPEAISNQKRGVKVLKQELGGLG
ISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAG
KEVLLEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGGGSSDPLSSQSFSFHRDRKSI
PLKMCYVTRSMALADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSAIHSNVSDLLPRV
IAEVREQLGKTGIAGSQEVRHLGWLAEKVPGESEKQWKPALVVLTEKDLLIYDSMPRRKE
AWFSPVHSYPLLATRLVHSGPGKGSPQAGVDLSFATRTGTRQGIETHLFRAEISRDLSHW
TRSIVQGCHNSAELISEITTACTYKNQECRLTIHYENGFSLTTEPQEGAFPKTIIQSPYE
KLKMSSDDGIRMLYLDFGGKDGEFQLDLHSCPKPIVFIIHSFLSAKITRLGLVA
Download sequence
Identical sequences F7AZK8
ENSECAP00000014905 9796.ENSECAP00000014905 ENSECAP00000014905 XP_005613453.2.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]