SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015211 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015211
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000314
Family Elafin-like 0.00046
Further Details:      
 
Domain Number 2 Region: 28-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000602
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015211   Gene: ENSECAG00000017609   Transcript: ENSECAT00000018637
Sequence length 123
Comment pep:known_by_projection chromosome:EquCab2:22:34540836:34544310:1 gene:ENSECAG00000017609 transcript:ENSECAT00000018637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACRLGPLAGLLLGLLLFDHPAVTGTGAEKKGVCPKLEADSTCKKECLSDGECADNLKC
CQAGCSSVCHLPNEKQGSCPLVDSNFPQLGLCQDQCQVDSQCPDKKKCCLNGCGKVSCVT
PHF
Download sequence
Identical sequences F6QP34
XP_001503325.1.31192 XP_008505179.1.77740 9796.ENSECAP00000015211 ENSECAP00000015211 ENSECAP00000015211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]