SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015227 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015227
Domain Number 1 Region: 282-424
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015227   Gene: ENSECAG00000017218   Transcript: ENSECAT00000018655
Sequence length 868
Comment pep:known_by_projection chromosome:EquCab2:22:26763987:26813163:1 gene:ENSECAG00000017218 transcript:ENSECAT00000018655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAADATTPVTPAGHGHPEANSNEKHLPQQDTRPAEQS
LDMEEKDYGEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDSDKREEDGESGGRRSEAEEGELRTPTKIK
ELKFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPE
KANERAGLREGSEEKVKPPRPKAPESDTGDEDQDQERDAVFLKDNHLAIERKCSSITVSS
TSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSEPEGLVFSRDLNKGGPGQDDES
GGIEDSPDRGACSTLDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVSTVDTSQVDGT
APGGKEFMPTTPSITTETISTTMENSVKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLT
STYSATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQH
PDMLVTKAVVYRETDPSPEERDKKPQES
Download sequence
Identical sequences F6QNF0
XP_005604661.2.31192 XP_014706281.1.49734 ENSECAP00000015227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]