SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015520 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000015520
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.055
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015520   Gene: ENSECAG00000017995   Transcript: ENSECAT00000018987
Sequence length 200
Comment pep:known_by_projection chromosome:EquCab2:13:41791150:42069102:-1 gene:ENSECAG00000017995 transcript:ENSECAT00000018987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSREAGSCRVGPGARARARKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSL
CKDSLSLLLDSPDWACRRAPAVPRPRAATPDGPADPTDPGGQPQGAWLPDAPTTPDLVVA
DVLSLRRCVGGPXARALPPGPPPPSARDWEKGPGPAGCKDRAWDLRLAGDPRGLGSPAGP
TWAGPQGSVKPQGTPPAPGQ
Download sequence
Identical sequences F6PVT4
ENSECAP00000015520 9796.ENSECAP00000015520 ENSECAP00000015520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]