SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015528 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015528
Domain Number 1 Region: 244-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-40
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 494-687
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-28
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 3 Region: 171-261,458-507
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000126
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 820-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000213
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 691-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 726-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000469
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015528   Gene: ENSECAG00000017701   Transcript: ENSECAT00000018995
Sequence length 1818
Comment pep:known_by_projection chromosome:EquCab2:5:58798264:58819936:-1 gene:ENSECAG00000017701 transcript:ENSECAT00000018995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLVSAQCALRVTIITDEMLTHSITLRLEDMSPERFLSPLLGLFIQAVAATLATPPDHV
VVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFLPSEDLQERLYLNRSLLTAISAQRV
LPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSSVLFRPIHPVGGLRCRCPRGFTGDY
CETEVDLCYSRPCGPHGRCRSREGGYTCLCRDGYTGEHCEVSARSGRCTPGVCKNGGTCV
NLLVGGFKCDCPSGDFEKPYCQVTTRSFPARSFITFRGLRQRFHFTLALSFATKERNGLL
LYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVSPFVPGGVSDGQWHTVQLKYYNKPL
LGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGAVLGNYSCAAQGTQGGSKKSLDLTGPLL
LGGVPDLPESFPVRTRHFVGCMRNLQVDSRHMDMADFIANNGTVPGCPAKKNVCDSNTCH
NGGTCVNQWDSFSCECPLGFGGKSCAQEMANPQRFLGSSLVAWHGLSLPISQPWHLSLMF
RTRQADGVLLQAVTRGRSTITLQLREGHVVLSVEGTGLQASSLQLEPGRANDGDWHHAQL
ALGASGGPGHAILSFDYGQQRAEGNLGPRLHGLHLSNITVGGVPGPASGVARGFRGCLQG
VRVSETPEGVSSLDPSRGESINVEPGCSLPDPCDSNPCPANSYCSDDWDSYSCSCDPGYY
GDNCTNVCDLNPCEHQSTCTRKPSAPHGYTCECPQNYLGPYCETRVDQPCPRGWWGHPTC
GPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPTCLLCDCYPTGSLSRVCDPEDGQCP
CKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAIEAGIWWPRTRFGLPAAAPCPKGSF
GTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERLQRNESGLDSGRSQWLALLLRNATQ
HTAGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQDVHFTENLLRVGSALLDAANKRHW
ELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKL
PRYEALRGERPPDLETTVILPESVFRETTPVVRPAGPGEAQEPEELARRQRRHPELSQGE
AVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPVINTPVVSISVHDDEELLPRALDKPVTV
QFRLLETEERTKPICVFWNHSILVSGTGGWSARGCEVVFRNESHVSCQCNHMTSFAVLMD
VSRRENGEILPLKTLTYVALGVTLAALLLTFLFLTLLRALRSNQHGIRRNLTAALGLAQL
VFLLGINQADLPFACTVIAILLHFLYLCAFSWALLEALHLYRALTEVRDVNAGPMRFYYM
LGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLIWSFAGPVAFAVSMSVFLYILAARA
SCAAQRQGFEKKGPVSGLRPSFAVLLLLSAAWLLALLSVNSDTLLFHYLFAACNCIQGPF
IFLSYVVLSKEVRKALKFACSRKPSPDPALTTKSTLTSSYNCPSPYADGRLYQPYGDSAG
SLHSASRSGKSQPSYIPFLLREESTLNPGQGPPGLGDPGGLFLDGQDQQHDPDTDSDSDL
SLEDDQSGSYASTHSSDSEEEEEEEEEAAFPGEPGWDSLLGPGAERLPLHSTPKDGGVGP
GKAPWPGDFGTTAKESGGNGASEERPRENGDALPREGSLGPFPGPSAQPHKGILKKKCLP
TISEKSSLLRLPMEQGTGSSRGSSASEGSRGGPPPRPPPRQSLQEQLNGVMPIAMSIKAG
TVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences F6PVK7
9796.ENSECAP00000015528 ENSECAP00000015528 ENSECAP00000015528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]