SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015538 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015538
Domain Number 1 Region: 1-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.79e-61
Family BAR domain 0.00000000292
Further Details:      
 
Domain Number 2 Region: 431-585
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-27
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 
Domain Number 3 Region: 242-337
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-22
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015538
Domain Number - Region: 572-618
Classification Level Classification E-value
Superfamily Gam-like 0.0353
Family Gam-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015538   Gene: ENSECAG00000017473   Transcript: ENSECAT00000019006
Sequence length 660
Comment pep:known_by_projection chromosome:EquCab2:16:31045223:31070436:-1 gene:ENSECAG00000017473 transcript:ENSECAT00000019006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDEL
SSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKREN
DKVKYEVIEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSE
NLSEQLEEFLTNIGTSVQNVRREMDSDVETMQQTIEDLEVASDPLYVPDPDPMKFPVNRN
LTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCE
DRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSENPEEIAARVNQSALE
AVTPSPSFQQRHESLRPAGNVFSSGSLGSESTSLAALSLDSLVAPDTPIQFDIISPPGQA
KASSQGNRRTNPFGESGGGTKSETEDSILHQLFIVRFLGSMEVKSDDNPDVVYETMRQIL
AARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPSVVLYATHQENKRLFGFVLR
TSGGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQ
QKELSKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEEGKKRESEA
Download sequence
Identical sequences F6PPE5
9796.ENSECAP00000015538 ENSECAP00000015538 ENSECAP00000015538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]