SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015557 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015557
Domain Number 1 Region: 151-266
Classification Level Classification E-value
Superfamily C-type lectin-like 9.12e-43
Family Link domain 0.0049
Further Details:      
 
Domain Number 2 Region: 665-814
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-42
Family C-type lectin domain 0.00000565
Further Details:      
 
Domain Number 3 Region: 267-360
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-30
Family Link domain 0.0069
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000402
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 5 Region: 814-873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015557   Gene: ENSECAG00000017725   Transcript: ENSECAT00000019029
Sequence length 912
Comment pep:known_by_projection chromosome:EquCab2:5:41625139:41641829:-1 gene:ENSECAG00000017725 transcript:ENSECAT00000019029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLFLCLLAALALARVPAAFADALETDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSGGREAEVLVARGLRVKVSEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACA
RIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGAPPDKLTLEEARAYCRERGAEIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AIPEDYNPVSDPASDRLEAIVTVTETLEELQLPQEAVESESRGAIYSIPIVEDGGGGSST
PEDPAEAPRTLLEFETQSMVPPLGSSEEESEALEEEEKYKDEEDKDQEEEEEEVEDDALW
AWPNELSSPEPEASLTTELALEESVSQASPPARAVLQPGASPPPDGEPEASRPPGVLGPP
AETLLTPREGNLASAPPSTPDGAREVGEETGGLELSGVPRGESEETGSSEDAPALLPATQ
APEGTRELEAPSEENSGRTVPAGTSVQAQPVLPTDSASRGGVAVAPSSGDCVPSPCHNGG
TCVEEEEGVRCLCLPGYGGDLCDVGLRFCSPGWDAFQGACYKHFSTRRSWEEAETQCRMY
GAHLTSISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFL
SGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTV
LRYRCREGLAQRNLPLIRCQENGLWEPPQISCVPRRPARALRPVKAPEGHQGRLLGHWKA
LLTPPSSPAPGP
Download sequence
Identical sequences F6PNK4
ENSECAP00000015557 9796.ENSECAP00000015557 XP_001500413.3.31192 XP_014595441.1.31192 XP_014595442.1.31192 ENSECAP00000015557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]