SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015611 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015611
Domain Number 1 Region: 407-713
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.05e-54
Family Eukaryotic proteases 0.00067
Further Details:      
 
Domain Number 2 Region: 99-215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 273-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000131
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 210-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000381
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015611   Gene: ENSECAG00000018049   Transcript: ENSECAT00000019089
Sequence length 713
Comment pep:known_by_projection chromosome:EquCab2:12:2088207:2139614:-1 gene:ENSECAG00000018049 transcript:ENSECAT00000019089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYTVVNEGCPGAEWNIMCRECCEYDQIECVCPGRKEVVGYTIPCCRNEENECDSCLIHPG
CTIFENCKACRNGSWGGALDDFYVKGVYCAECRAGWYGGDCMRCGQVLRAPKGQILLESY
PLNAHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYDYVEVRDGDDSDGQIIKRFCGNERP
APIRSSGSSLHILFHSDGSKNFDGFHAIFEEVTACSSSPCFHDGTCLLDRTGSYKCACLA
GYTGQHCENREYASRVGVKVLFFSLLVLQEGNCTDPGGPVNGYRKITGGPGLINERYAKI
GTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICIKACREPKVSDLVRRRVLPMQVQSR
ETPLHQLYSSAFSKQKLQAAPTKKPALPFGDLPAGYQHLHTQLQYECISPFYRRLGSSRR
TCLRTGKWSGRAPSCIPICGKTENITAPKTQGLRWPWQAAIYRRASGVHGGSLQKDAWFL
VCSGALVNERTVVVAAHCVTDLGKVTVIKTGDLNVVLGKFYRDDDRDEKTIQSLRISAII
LHPNYDPILLDADIAVLKLLDKARISTRVQPICLAAPRDLSTSFQESRITVAGWNVLADV
RSPGFKNDTLRSGVVRVVDSLLCEEQHEERGIPVSVTDNMFCASRDPTAPSDICTAETGG
ISAVSFPGRASPEPRWHLVGLVSWSYDKTCSHSLYTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences F6S0X9
ENSECAP00000015611 9796.ENSECAP00000015611 ENSECAP00000015611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]