SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015701 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015701
Domain Number 1 Region: 176-349
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.1e-54
Family Reprolysin-like 0.0000062
Further Details:      
 
Domain Number 2 Region: 407-470
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 7.07e-17
Family Blood coagulation inhibitor (disintegrin) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015701   Gene: ENSECAG00000017922   Transcript: ENSECAT00000019198
Sequence length 888
Comment pep:known_by_projection chromosome:EquCab2:14:21691499:21767122:1 gene:ENSECAG00000017922 transcript:ENSECAT00000019198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSGEGSPLLQHELTIPQWKTAESPTKEKHPLKAELRVMAEGRELILDLEKNEHLFAPAY
TETHYTPSGNPQTTTLKSEDHCFYHGTVRKAEQSSVTLSTCRGMRGLIMVSSNLSYIIEP
LPDSEGHHLIYRSEHLKLPPGNCGFEHSKPTARDWVLPFTNQTKKRPHRIKREDLHSMKY
VELYLVADYAEFQKNRRDQDATKYKLMEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEV
SENPYSTLWSFLSWRRKLLTQKNHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMD
HSENAIGVAATMAHEMGHNFGMSHDSADCCSASSADGGCIMAAATGKTGPELTSWCHIRT
RDPNQRTPGRREVELLPGPESLFGKRHDGKKHGMLEGKEHVCLEPRECSNPCCNASNCTL
REGAECAHGSCCHHCKLLAPGTLCREQARQCDLPEFCTGESPHCPTNFYQMDGTPCEGGQ
AYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNGEHKKCNMRDA
KCGKIQCQSNEARPLESNAVPIETTITMNGRQIRCRGTHVYRGPEEEGDMLDPGLVMTGT
KCGYNHICFEGQCRNTSFFETEGCSKKCNGQGVCNNNQNCHCFRGWAPPFCNTPGLGGSI
DSGPMPPESVGAVVAGVFTAIFVLVALMLMYYCCRQNNKLGQLKPLALPSKLRQQFSCPF
RVSHNSGTGHANPTFKLQTPQGKRKVTNTPETPRKPSQPPPRPPPDYLHGGTLPAPLSAH
LSRAARNSLGAGSQVERSESSRRPPPSRPVPPAPNCILSQDFSRPRPPQKALPANPVPGR
KSLPRPGGTSILRPTAADPQQSRPLVAPAPKFPDYRSQRSGMMTSSKI
Download sequence
Identical sequences F6QJY1
9796.ENSECAP00000015701 ENSECAP00000015701 ENSECAP00000015701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]