SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015713 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015713
Domain Number 1 Region: 105-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000621
Family Complement control module/SCR domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000121
Family Complement control module/SCR domain 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015713   Gene: ENSECAG00000018057   Transcript: ENSECAT00000019212
Sequence length 223
Comment pep:known chromosome:EquCab2:29:27893321:27899959:1 gene:ENSECAG00000018057 transcript:ENSECAT00000019212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAELCEDDPPTLRHATFKALTYKVGTLLNCNCEKGFRRISKGSLAMVCKGNSSHSFWEQT
CHCVRTSSRKTEKQVTPKPEEQMEGKTTEMQSQTQPMDPVNLPGHCREPPPWEHEASERI
YHFVVGQTVHYQCAQGFRALQSGPAKSVCKMMCGRTRWTQPQLRCTSESKNSEFAGDKEL
QASTDASPGSETSCPLIMTDFQTRTEVAATTETFIFTAEYQMA
Download sequence
Identical sequences F6QJD9
9796.ENSECAP00000015713 ENSECAP00000015713 ENSECAP00000015713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]