SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015720 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015720
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.12e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.8e-53
Family I/LWEQ domain 0.000000256
Further Details:      
 
Domain Number 3 Region: 2294-2485
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.36e-48
Family I/LWEQ domain 0.000000535
Further Details:      
 
Domain Number 5 Region: 1840-1972
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-46
Family VBS domain 0.000000481
Further Details:      
 
Domain Number 6 Region: 1224-1360
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.32e-38
Family VBS domain 0.013
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-33
Family Second domain of FERM 0.000000588
Further Details:      
 
Domain Number 8 Region: 1074-1206
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-27
Family VBS domain 0.032
Further Details:      
 
Domain Number 9 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 10 Region: 1410-1554
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000183
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000183
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 2009-2131
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000675
Family VBS domain 0.027
Further Details:      
 
Domain Number 13 Region: 1694-1813
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000091
Family VBS domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015720
Domain Number - Region: 949-1041
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00883
Family I/LWEQ domain 0.0052
Further Details:      
 
Domain Number - Region: 1597-1657
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0091
Family VBS domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015720   Gene: ENSECAG00000016464   Transcript: ENSECAT00000019221
Sequence length 2540
Comment pep:known_by_projection chromosome:EquCab2:25:931320:956441:-1 gene:ENSECAG00000016464 transcript:ENSECAT00000019221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRECIPEALTGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQISEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDEQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAARQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQMVLHLPTRSLQPGGKMVAAAKASVPTIQDQASAMQLS
QCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLERDLQEVKAAARDGKLKPLPG
ETMEKCAQDLGNSTKAVSSAMAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAAL
TSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCVS
CLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQASR
GSPQDLARASGRFGQDFNTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKA
LSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPV
QPVNDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIATASKALCGFTEAAA
QAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKH
TSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAA
TAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALA
VNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLA
AVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAAQAEASQLGHKVSQMAQYFEPL
TLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQ
MMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPESSFVDYQTTMVRTA
KAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQ
ELGHGCAALVTKAGALQCSPSDTYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITA
ASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQ
EKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAA
AGKAGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFC
SPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKE
AAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSVT
ELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNF
EEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVA
AATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGN
AVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKK
LAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences F6QIZ4
ENSECAP00000015720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]