SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015788 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015788
Domain Number 1 Region: 870-1171
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.93e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000013
Further Details:      
 
Domain Number 2 Region: 214-358
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-35
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-212
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-19
Family Second domain of FERM 0.00064
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-18
Family First domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015788   Gene: ENSECAG00000017641   Transcript: ENSECAT00000019298
Sequence length 1175
Comment pep:known_by_projection chromosome:EquCab2:24:32166373:32238191:-1 gene:ENSECAG00000017641 transcript:ENSECAT00000019298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTIYFGVVFYVPSVSQLQQEITRHQY
YLQLKKEILEGTSCTLESIQLAGLAVKQSDFGDFDQYESQDFLQKFALFPVGWLQDEKIL
EEATQKVALLHQKYRGLTAPDAEILYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGI
FVKHKNGRPPVIFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVARH
KFYRLNQCSLQTQTVTVNPIRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYTSSQDN
LFVTNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYMQPSPMSSNPSI
TGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGMAHAERQSHSLRNLSIGNSY
AYSRPDALVYSQPEIREHAHFTSPQSAHYPFNLNYSFHSQSPYPYPAERRPVVGAVSVPE
LTNVQLQAQEYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLITRRVHH
SVQTFQEDSLPVAHSLQEVSEPLTSARHAQLQKRNSIEIAGLTHSFEGMRLKERTMSASA
ADVAPRAISAGSQPNVFIERTKQEETDEQESLRYGHKKSSDATMLIHSSEEEEDFEEESK
AQAALPLRAREPRGGYSQDLQPSYACGSVAAVAGPLHILEPKSHVTETEKRVQDSSPVHM
LVEAPRPRRDGLLTPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKHIVEGLPPLGGM
KKSRVDAKKIGPLKLAALNGLSLSRLPLPDEGNEVPTRATNDERCKILEQRLEQGMVFTE
YERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVS
VSGIEWDYIATQGPLQNTCQDFWQMVWEQGVAIIAMVTAEEEGGREKSFRYWPRLGSRHN
TVTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLS
YLEEIQSVRRHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRV
LDMLRQQRMMMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences F6Q3L2
ENSECAP00000015788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]