SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015867 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015867
Domain Number 1 Region: 102-290
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.61e-75
Family T-box 0.000000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015867   Gene: ENSECAG00000018182   Transcript: ENSECAT00000019390
Sequence length 449
Comment pep:known_by_projection chromosome:EquCab2:4:64896994:64947501:-1 gene:ENSECAG00000018182 transcript:ENSECAT00000019390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTS
LDAHGEFGGSGGGRSSPSSSSLCTEPLIPTTPIIPSEEMAKITCSLETKELWDKFHELGT
EMIITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPP
LPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKD
HTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERE
SVESLIQKHSYARSPIRTYGGEEDVLGDEVQTTQNRGSAFTTSDNLSLSSWVSSSSSFPG
FQHPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHM
PRYHHYFQQGPYAAIQGLRHSSAVMTPFV
Download sequence
Identical sequences F7CIF3
9796.ENSECAP00000015867 XP_001500092.2.31192 XP_008521924.1.77740 ENSECAP00000015867 ENSECAP00000015867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]