SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015921 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015921
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily EF-hand 2.92e-30
Family Calmodulin-like 0.0000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015921   Gene: ENSECAG00000018203   Transcript: ENSECAT00000019452
Sequence length 191
Comment pep:known_by_projection chromosome:EquCab2:1:93205055:93208399:1 gene:ENSECAG00000018203 transcript:ENSECAT00000019452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEHRSVEESLQIRVSLEQILS
LPELKANPFKERICRVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNRDDLSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
Download sequence
Identical sequences F7CUM5
9796.ENSECAP00000015921 XP_001502910.1.31192 ENSECAP00000015921 ENSECAP00000015921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]