SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016315 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016315
Domain Number 1 Region: 126-317
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.99e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 505-570
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.74e-20
Family SAM (sterile alpha motif) domain 0.0000187
Further Details:      
 
Domain Number 3 Region: 353-393
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000419
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016315   Gene: ENSECAG00000018546   Transcript: ENSECAT00000019898
Sequence length 641
Comment pep:known_by_projection chromosome:EquCab2:19:27207319:27428546:1 gene:ENSECAG00000018546 transcript:ENSECAT00000019898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSTQTSEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSENGATNKIEISMDCIRMQ
DSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDAL
SPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPP
PQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDP
ITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
FEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDE
LLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQSQSSY
GNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGL
SPTQALPPPLSMPSTSHCTPPPPYPTDCSLVSFLARLGCSSCLDYFTTQGLTTIYQIEHY
SMDDLASLKIPEQFRHAIWKGILDHRQLHDFSSPPHLLRTPSGASTVSVGSSETRGERVI
DAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences F7B2P6
XP_020925704.1.46622 9796.ENSECAP00000016315 ENSECAP00000016315 ENSECAP00000016315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]