SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016361 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016361
Domain Number 1 Region: 13-183
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-49
Family DBL homology domain (DH-domain) 0.0000303
Further Details:      
 
Domain Number 2 Region: 169-310
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-34
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 330-440
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 425-554
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.65e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 529-623
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000189
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016361   Gene: ENSECAG00000018479   Transcript: ENSECAT00000019952
Sequence length 1551
Comment pep:known_by_projection chromosome:EquCab2:9:17215075:17486450:-1 gene:ENSECAG00000018479 transcript:ENSECAT00000019952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQCAASKVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHF
KDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQR
ICKYPLLLKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIE
GWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGH
RYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEW
FEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLG
SEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPR
NEMQDVISKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEA
MIFGVGLCDNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAK
SLLIKSTEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFTINGDLVFMRPFNEV
DCFLKSCLNSRKPLRVLVSTKPREMVRVPVSIQKNQFTFLGFWAIFPFVLKGTVAAAAGP
SPWTMYIKVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSVESAQEDLQKSTS
KPPGEEAGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNIHLEYGVVYEYDSTAGIKC
NVVEKMIEPKGFFSLTAKILEALAKSDDHFVQNCASLNSLNEVIPTDLQSKFSAICSEIE
HVCQRISQSGKFSRVLRNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSL
GSAFGVQLDSRKHNSHDKENKSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLL
KEEDLETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSECVVPTDSDN
EKGERNSKRVCFNMAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHS
DEMDSGDELPLSVRISHDKQDKIHSCLEHLFSQVDAITNLLKGQAVVRAFEQTKSLTPGR
GLQEFQQEMESKLSCPKKLRLHIKQDPWNLPSSVRNLAQNIRKFVEEVKCRILLALLEYS
DSETQLRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIASAG
VLFHFQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQ
ALKVYFSIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINA
ASLEKVRQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRT
AACANTACSASGVGLLSVSSELCSRLGACHIIMCNSGVHRCTLSVTLEQAIILARSHGLP
PRYIMQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPAAGEE
Download sequence
Identical sequences F7AVW6
ENSECAP00000016361 ENSECAP00000016361 9796.ENSECAP00000016361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]