SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016497 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016497
Domain Number 1 Region: 210-342
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 108-212
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 26-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.48e-25
Family First domain of FERM 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016497   Gene: ENSECAG00000018914   Transcript: ENSECAT00000020115
Sequence length 864
Comment pep:known_by_projection chromosome:EquCab2:25:14531451:14661128:-1 gene:ENSECAG00000018914 transcript:ENSECAT00000020115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGGGHLLPGGAAVHMSAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDL
VETDYFGLQFLDSAQVAHWLDHSKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYL
FVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAME
FDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFE
GANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVE
HHAFFRLRMPGNSKSSRSDFIRLGSRFRFSGRTEYQATHGARLRRTSTFERKPSKRYPSR
RHSTFKASNPVIAAQLCSKPNPEVHNYQPQYHANIHPGQPRWHPHSPNVSYPLPSPGLSS
SDRLPFGIEENGGTPFTTKASGRHHHHHHQHQHHPNYGLSLTLENKEGPLRSPNSSSKSL
TKLSPGAPALFSEAAAHLKKLELETVKAAGPWPALHININKAEEKKVSEKTLQTPILPSP
VADHVKCNILKAQLENASRASAQVGKEESTFVNINKKSSLQDANVRSPIPIRVETTQPAV
EKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGATTTPTTNTTAAATTQVSAPLVSPQVR
KVSSPQNSDGKGQLSPGAKSPSNRGGAFTLEPGDLLMDFTEATPLAEPASAPHCAHSRCS
PPLSLPMKEETTGVCMHPPIKTRLIKTFPADTVTPFPDPFITGPQFTADFRDGKLQCCPG
QSSPLIPAATLRPLTETVSTVQTIYTPQACLSGSQCRDAPAGTGERENDEKTVDDRTVTF
CPCCLEDGMVPSVRSHSLGFVCSL
Download sequence
Identical sequences F6ZZK6
ENSECAP00000016497 9796.ENSECAP00000016497 ENSECAP00000016497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]